DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Ppp4c

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001347393.1 Gene:Ppp4c / 56420 MGIID:1891763 Length:307 Species:Mus musculus


Alignment Length:304 Identity:183/304 - (60%)
Similarity:233/304 - (76%) Gaps:1/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRT 65
            :.|:|:.||.:::|:.:.|:|:|.||....:||:||:|:..|.:|||||||||||||||::|||.
Mouse     4 ISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRV 68

  Fly    66 GGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSK 130
            ||.||.|||:|||||||||:||:|||..||.||.|||.||||:|||||:||||:||||:|||..|
Mouse    69 GGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRK 133

  Fly   131 YGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWS 195
            ||:...|:||.::||.|:::||||.::.||||||||.|.||||||||||..|:|:.|..|||:||
Mouse   134 YGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWS 198

  Fly   196 DPEDMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYC 260
            ||||...||.||||||:|||.:|...|.|.|::::||||||||.||.|:.|:..::|||||||||
Mouse   199 DPEDTTGWGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYC 263

  Fly   261 YRCGNVAAILSFETAEKRQTKIFLAVPDAERVIP-KQNTTPYFL 303
            ||||||||||..:...::...||.|.|...|.|| |:....|||
Mouse   264 YRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKPVADYFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 181/300 (60%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 175/283 (62%)
Ppp4cNP_001347393.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 175/283 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.