DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and ppp3cca

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_005171933.1 Gene:ppp3cca / 557926 ZFINID:ZDB-GENE-030829-36 Length:508 Species:Danio rerio


Alignment Length:257 Identity:112/257 - (43%)
Similarity:158/257 - (61%) Gaps:15/257 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLL 95
            :||.:|..:|.|..|:|||||:||||:||.:||..||...:|.|:|:||:|||||:|:|....|.
Zfish    68 NILRQEKCMLEVEAPITVCGDVHGQFFDLMKLFEVGGSPDNTRYLFLGDYVDRGYFSIECVLFLW 132

  Fly    96 TLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCV 160
            |||..:|:.:.|||||||.|.:|:.:.|..||..|| :...:..|.:.||.|.:||:::::.|||
Zfish   133 TLKINHPNTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMEAFDCLPLAALLNQQFLCV 196

  Fly   161 HGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDP-ED------MEYWG-QSPRGAGWLFGHN 217
            ||||||||..||.||.:||..|.|..|..|||:|:|| ||      .|::. .|.||..:.|.:.
Zfish   197 HGGLSPEINCLDDIRKLDRFKEPPAFGPMCDLIWADPGEDYGSEKTAEHFNHNSVRGCSYFFSYA 261

  Fly   218 VTKDFMAINNLNLICRAHQLVNEGIKYMFDGK------LVTVWSAPNYCYRCGNVAAILSFE 273
            ...||:..|||..:.|||:..:.|.:.....:      |:|::|||||.....|.||:|.:|
Zfish   262 AVCDFLTNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 112/257 (44%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 112/257 (44%)
ppp3ccaXP_005171933.1 MPP_PP2B 39..343 CDD:277361 112/257 (44%)
PP2Ac 59..327 CDD:197547 112/257 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.