Sequence 1: | NP_001259272.1 | Gene: | PpV / 31582 | FlyBaseID: | FBgn0003139 | Length: | 303 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006230.2 | Gene: | PPEF2 / 5470 | HGNCID: | 9244 | Length: | 753 | Species: | Homo sapiens |
Alignment Length: | 363 | Identity: | 93/363 - (25%) |
---|---|---|---|
Similarity: | 135/363 - (37%) | Gaps: | 132/363 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 LLEETNILPVST----PVTVCGDIHGQFYDLEQLF-RTGGQVPHTNYIFMGDFVDRGYYSLETFT 92
Fly 93 RLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANG---WKYCCKVFDLLTIAAIID 154
Fly 155 EEVLCVHGGLS--PEIITLDQI------------------------------------------- 174
Fly 175 ----------------RTIDRNGEIPYKGAF-------------------C-------------- 190
Fly 191 ---------------------------DLVWSDPEDME-YWGQSPRGAGWLFGHNVTKDFMAINN 227
Fly 228 LNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGN 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
PpV | NP_001259272.1 | PTZ00239 | 3..303 | CDD:173488 | 93/363 (26%) |
MPP_PP2A_PP4_PP6 | 3..287 | CDD:277360 | 93/363 (26%) | ||
PPEF2 | NP_006230.2 | MPP_RdgC | 122..537 | CDD:277364 | 93/363 (26%) |
Catalytic | 128..540 | 93/363 (26%) | |||
PP2Ac | 141..540 | CDD:197547 | 93/363 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 318..382 | 4/63 (6%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 409..435 | 0/25 (0%) | |||
EFh | 657..722 | CDD:238008 | |||
EF-hand_7 | 657..721 | CDD:290234 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 732..753 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0639 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000018 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |