DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and PpD6

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster


Alignment Length:272 Identity:117/272 - (43%)
Similarity:169/272 - (62%) Gaps:12/272 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KCKYLP--ENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYI 75
            |.:.||  |:|:..||.:..::.|:|..:|.|..|:.|.||||||||||.::....|..|.|.|:
  Fly    46 KMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYL 110

  Fly    76 FMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYC 140
            |:||:||||..|:||.|.||.|:.::|..|.|||||||::.:.:||||||||..:| ....||..
  Fly   111 FLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRY-TVKLWKTF 174

  Fly   141 CKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPEDMEY-WG 204
            ...::.:.:||||...:.|.||||||::..|..|.:|.|..|:|..|..|||:||||:...: |.
  Fly   175 VDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWT 239

  Fly   205 QSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAA- 268
            .|.||..:|:|.:|.:.|:..|:.:|:|||||:|.:|.::....:||||:||||||....|..| 
  Fly   240 SSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGAS 304

  Fly   269 -------ILSFE 273
                   ::||:
  Fly   305 MGVDKDLVISFD 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 117/272 (43%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 117/272 (43%)
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 115/267 (43%)
PP2Ac 54..315 CDD:197547 112/261 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438881
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.