DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Pp1-13C

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster


Alignment Length:275 Identity:120/275 - (43%)
Similarity:171/275 - (62%) Gaps:13/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFV 81
            |.|.|::.||....:|||.:..:|.:..|:.:|||||||:|||.:||..||..|..||:|:||:|
  Fly    28 LSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYV 92

  Fly    82 DRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDL 146
            |||..||||...||..|.:|.....|||||||...|.::|||:|||..:| ....||.....|:.
  Fly    93 DRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFNC 156

  Fly   147 LTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPE-DMEYWGQSPRGA 210
            |.:.||:||::.|.||||||::.:::|||.|.|..::|.:|..|||:||||: |...||::.||.
  Fly   157 LPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGV 221

  Fly   211 GWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFET- 274
            .:.||..|...|:..::|:|||||||:|.:|.::....:|||::||||||....|..|::|.:. 
  Fly   222 SFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNT 286

  Fly   275 ----------AEKRQ 279
                      .|||:
  Fly   287 LMCSFQILKPVEKRK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 120/275 (44%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 120/275 (44%)
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 117/271 (43%)
MPP_PP1_PPKL 6..296 CDD:277359 117/268 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438855
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.