DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and PpD5

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_524707.1 Gene:PpD5 / 44148 FlyBaseID:FBgn0005778 Length:346 Species:Drosophila melanogaster


Alignment Length:255 Identity:112/255 - (43%)
Similarity:166/255 - (65%) Gaps:2/255 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFV 81
            |.|..:..:|:...::.|.:..:|.:|.||.:|||:||||.||.::|:..|..|.:||:|:||:|
  Fly    45 LSEATITYICQASRELFLSQPMLLELSAPVKICGDLHGQFKDLLRIFQQCGVPPLSNYLFLGDYV 109

  Fly    82 DRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDL 146
            |||:.|:||.:.|||.|.|||....|||||||:..:.:||||||||..:| :...|:.....:|.
  Fly   110 DRGHCSIETLSLLLTYKLRYPETFFLLRGNHESADLNRVYGFFDECKRRY-SIKLWRSFVDCYDC 173

  Fly   147 LTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPEDME-YWGQSPRGA 210
            :.:||||.:.:.||||||||::..||.||.::|..::|..|..|||:||||::.. .|..:.||.
  Fly   174 MPVAAIIADRIFCVHGGLSPDLNNLDDIRRLNRPTDVPSDGLLCDLLWSDPDETTGTWASNDRGV 238

  Fly   211 GWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAIL 270
            .:.||.|:.:.|:..:..|||.||||:|.:|.::..|.:|||::||||||....|..|:|
  Fly   239 SFTFGANIVEGFLMQHKFNLIVRAHQVVEDGYEFFADRQLVTIFSAPNYCDIFDNCGAVL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 112/255 (44%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 112/255 (44%)
PpD5NP_524707.1 PTZ00480 19..339 CDD:185658 112/255 (44%)
MPP_superfamily 25..313 CDD:301300 112/255 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438789
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.