DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Pp1alpha-96A

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001262919.1 Gene:Pp1alpha-96A / 42922 FlyBaseID:FBgn0003134 Length:327 Species:Drosophila melanogaster


Alignment Length:275 Identity:119/275 - (43%)
Similarity:172/275 - (62%) Gaps:13/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFV 81
            |.|:|::.||....:|.|.:..:|.:..|:.:|||||||:|||.:||..||..|.:||:|:||:|
  Fly    28 LSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYV 92

  Fly    82 DRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDL 146
            |||..||||...||..|.:|.....|||||||...|.::|||:|||..:| ....||.....|:.
  Fly    93 DRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFNC 156

  Fly   147 LTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPE-DMEYWGQSPRGA 210
            |.:|||:||::.|.||||||::.:::|||.|.|..::|.:|..|||:||||: |...||::.||.
  Fly   157 LPVAAIVDEKIFCCHGGLSPDLSSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGV 221

  Fly   211 GWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILS---- 271
            .:.||..|...|:..:..:|||||||:|.:|.::....:|||::||||||....|..|::|    
  Fly   222 SFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDDT 286

  Fly   272 -------FETAEKRQ 279
                   .:.|:||:
  Fly   287 LMCSFQILKPADKRR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 119/275 (43%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 119/275 (43%)
Pp1alpha-96ANP_001262919.1 MPP_PP1_PPKL 6..296 CDD:277359 116/268 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438760
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.