DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and rdgC

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster


Alignment Length:281 Identity:98/281 - (34%)
Similarity:143/281 - (50%) Gaps:46/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EDVKKCKYLPENELKKLCEMVCDILLEETNILPVST----PVTVCGDIHGQFYDLEQLFRTGGQV 69
            |..|..|.||                   ||.||||    .||||||:||:..||..:....|..
  Fly   216 EAAKSLKQLP-------------------NISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLP 261

  Fly    70 PHTN-YIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKY-- 131
            ..:| |:|.|||||||...||....||:|...:|:.:.|.|||||...:...|||..|..|||  
  Fly   262 SSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPR 326

  Fly   132 GNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDR------------NGE-- 182
            .:.....:..:|:..|.:.::::..||.||||.| :..:||.|::|||            :||  
  Fly   327 NHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYVSILRPPLTDGEPL 390

  Fly   183 --IPYKGAFCDLVWSDPE-DMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKY 244
              ..::..| |::||||: .|.....:.||||..||.:||.:|:..:.|:.:.|:|:....|.::
  Fly   391 DKTEWQQIF-DIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEF 454

  Fly   245 MFDGKLVTVWSAPNYCYRCGN 265
            |.|.|::|::||.|| |..|:
  Fly   455 MHDNKIITIFSASNY-YAIGS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 98/281 (35%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 98/281 (35%)
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 98/281 (35%)
EFh 616..681 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438804
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.