DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and ppp4c

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_988943.1 Gene:ppp4c / 394540 XenbaseID:XB-GENE-970535 Length:307 Species:Xenopus tropicalis


Alignment Length:304 Identity:184/304 - (60%)
Similarity:234/304 - (76%) Gaps:1/304 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDVDKWIEDVKKCKYLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRT 65
            :.|:|:.||.:::|:.:.|:|:|.||....:||:||:|:..|.:|||||||||||||||::|||.
 Frog     4 ISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRV 68

  Fly    66 GGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSK 130
            ||.||.|||:|||||||||:||:|||..||.||.|||.||||:|||||:||||:||||:|||..|
 Frog    69 GGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRK 133

  Fly   131 YGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWS 195
            ||:...|:||.::||.|:::||||.::.||||||||.|.||||||||||..|:|:.|..|||:||
 Frog   134 YGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWS 198

  Fly   196 DPEDMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYC 260
            ||||...||.||||||:|||.:|...|.|.||:::||||||||.||.|:.|:..::|||||||||
 Frog   199 DPEDTTGWGVSPRGAGYLFGSDVVAQFNAANNIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYC 263

  Fly   261 YRCGNVAAILSFETAEKRQTKIFLAVPDAERVIP-KQNTTPYFL 303
            ||||||||||..:...:::..||.|.|...|.|| |:....|||
 Frog   264 YRCGNVAAILELDEHLQKEFIIFEAAPQETRGIPSKKPVADYFL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 182/300 (61%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 176/283 (62%)
ppp4cNP_988943.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 176/283 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D349967at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.