DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and ppp1cbl

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_956210.1 Gene:ppp1cbl / 334597 ZFINID:ZDB-GENE-030131-6529 Length:281 Species:Danio rerio


Alignment Length:318 Identity:103/318 - (32%)
Similarity:156/318 - (49%) Gaps:67/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVDKWIE---DVKKCK-----YLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDL 59
            |||..|.   :|:.|:     .:.|.|::.||....:|.|.:..:|                   
Zfish     7 DVDSLISRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILL------------------- 52

  Fly    60 EQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFF 124
                                       .|||...||..|.:||....|||||||...|.::|||:
Zfish    53 ---------------------------ELETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 90

  Fly   125 DECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAF 189
            |||..:: |...||.....|:.|.||||:||::.|.||||||::.:::|||.|.|..::|..|..
Zfish    91 DECKRRF-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 154

  Fly   190 CDLVWSDPE-DMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTV 253
            |||:||||: |::.||::.||..:.||.:|...|:..::|:|||||||:|.:|.::....:|||:
Zfish   155 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 219

  Fly   254 WSAPNYCYRCGNVAAILS-----------FETAEKRQTKIFLAVPDAERVIPKQNTTP 300
            :||||||....|...::|           .:.:||:....:..:.....|.|.:..||
Zfish   220 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGMNSGRPVTPPRTATP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 103/318 (32%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 99/303 (33%)
ppp1cblNP_956210.1 PTZ00480 3..254 CDD:185658 97/293 (33%)
MPP_superfamily 7..251 CDD:301300 97/290 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.