DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Pp2B-14D

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster


Alignment Length:256 Identity:112/256 - (43%)
Similarity:152/256 - (59%) Gaps:15/256 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLT 96
            :|.:|..::.:..|||||||||||||||.:||..||....|.|:|:||:|||||:|:|....|.:
  Fly   137 LLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWS 201

  Fly    97 LKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVH 161
            ||..||..:.|||||||.|.:|:.:.|..||..|| :...:..|...||.|.:||:::::.||||
  Fly   202 LKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFDCLPLAALMNQQFLCVH 265

  Fly   162 GGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDP-EDME-------YWGQSPRGAGWLFGHNV 218
            |||||||..|:.||.:||..|.|..|..|||:|||| ||..       |...|.||..:.:.:..
  Fly   266 GGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAA 330

  Fly   219 TKDFMAINNLNLICRAHQLVNEGIKYMFDGK------LVTVWSAPNYCYRCGNVAAILSFE 273
            ..||:..|||..|.|||:..:.|.:.....:      |:|::|||||.....|.||:|.:|
  Fly   331 CCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 112/256 (44%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 112/256 (44%)
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 112/256 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438883
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.