DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_037197.1 Gene:Ppp1cb / 25594 RGDID:3376 Length:327 Species:Rattus norvegicus


Alignment Length:318 Identity:126/318 - (39%)
Similarity:188/318 - (59%) Gaps:21/318 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DVDKWIE---DVKKCK-----YLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDL 59
            :||..|.   :|:.|:     .:.|.|::.||....:|.|.:..:|.:..|:.:|||||||:.||
  Rat     7 NVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDL 71

  Fly    60 EQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFF 124
            .:||..||..|..||:|:||:||||..||||...||..|.:||....|||||||...|.::|||:
  Rat    72 LRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 136

  Fly   125 DECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAF 189
            |||..:: |...||.....|:.|.||||:||::.|.||||||::.:::|||.|.|..::|..|..
  Rat   137 DECKRRF-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLL 200

  Fly   190 CDLVWSDPE-DMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTV 253
            |||:||||: |::.||::.||..:.||.:|...|:..::|:|||||||:|.:|.::....:|||:
  Rat   201 CDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTL 265

  Fly   254 WSAPNYCYRCGNVAAILS-----------FETAEKRQTKIFLAVPDAERVIPKQNTTP 300
            :||||||....|...::|           .:.:||:....:..:.....|.|.:...|
  Rat   266 FSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 126/318 (40%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 123/303 (41%)
Ppp1cbNP_037197.1 MPP_PP1_PPKL 7..297 CDD:277359 121/290 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.