DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Ppp1cc

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001257912.1 Gene:Ppp1cc / 24669 RGDID:3377 Length:337 Species:Rattus norvegicus


Alignment Length:318 Identity:133/318 - (41%)
Similarity:192/318 - (60%) Gaps:33/318 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDVDKW--------IEDVKKCK-----YLPENELKKLCEMVCDILLEETNILPVSTPVTVCGDI 52
            |.|:||.        :.:|:..|     .|.|||::.||....:|.|.:..:|.:..|:.:||||
  Rat     1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI 65

  Fly    53 HGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQI 117
            |||:|||.:||..||..|.:||:|:||:||||..||||...||..|.:||....|||||||...|
  Rat    66 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 130

  Fly   118 TKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGE 182
            .::|||:|||..:| |...||.....|:.|.||||:||::.|.||||||::.:::|||.|.|..:
  Rat   131 NRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTD 194

  Fly   183 IPYKGAFCDLVWSDPE-DMEYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMF 246
            :|.:|..|||:||||: |:..||::.||..:.||..|...|:..::|:|||||||:|.:|.::..
  Rat   195 VPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFA 259

  Fly   247 DGKLVTVWSAPNYCYRCGNVAAILS-----------FETAEKRQTKIFLAVPDAERVI 293
            ..:|||::||||||....|..|::|           .:.|||::       |:|.|.:
  Rat   260 KRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK-------PNATRPV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 132/316 (42%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 129/308 (42%)
Ppp1ccNP_001257912.1 MPP_PP1_PPKL 8..298 CDD:277359 123/290 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.