DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Ppp1ca

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_113715.1 Gene:Ppp1ca / 24668 RGDID:3375 Length:330 Species:Rattus norvegicus


Alignment Length:297 Identity:128/297 - (43%)
Similarity:186/297 - (62%) Gaps:16/297 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LPENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFV 81
            |.|||::.||....:|.|.:..:|.:..|:.:|||||||:|||.:||..||..|.:||:|:||:|
  Rat    30 LTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYV 94

  Fly    82 DRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDL 146
            |||..||||...||..|.:||....|||||||...|.::|||:|||..:| |...||.....|:.
  Rat    95 DRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNC 158

  Fly   147 LTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPE-DMEYWGQSPRGA 210
            |.||||:||::.|.||||||::.:::|||.|.|..::|.:|..|||:||||: |::.||::.||.
  Rat   159 LPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGV 223

  Fly   211 GWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILS---- 271
            .:.||..|...|:..::|:|||||||:|.:|.::....:|||::||||||....|..|::|    
  Rat   224 SFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDET 288

  Fly   272 -------FETAEKRQTKI--FLAV-PDAERVIPKQNT 298
                   .:.|:|.:.|.  |..: |....:.|.:|:
  Rat   289 LMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNS 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 128/297 (43%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 125/284 (44%)
Ppp1caNP_113715.1 MPP_PP1_PPKL 8..298 CDD:277359 121/268 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.