DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Ppef1

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_011246120.1 Gene:Ppef1 / 237178 MGIID:1097157 Length:676 Species:Mus musculus


Alignment Length:307 Identity:99/307 - (32%)
Similarity:139/307 - (45%) Gaps:64/307 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VCDILLEETNILP-------VST----PVTVCGDIHGQFYDLEQLFRTGGQVPHTN--YIFMGDF 80
            |.::|.|...:|.       |.|    .:|:|||:||:..||..:|...| :|..|  |:|.|||
Mouse   168 VLEVLFEARKVLKQMPNFSHVKTFPAKEITICGDLHGKLDDLMLIFYKNG-LPSENNPYVFNGDF 231

  Fly    81 VDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCC---K 142
            ||||..|:|....||.....|||.:.|.|||||...:...|||..|...|| ..:|.|...   :
Mouse   232 VDRGNNSMEILMILLVCFLVYPSDLHLNRGNHEDFMMNLRYGFTKEILQKY-KLHGRKILQVLEE 295

  Fly   143 VFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRN----------------GEIPYKGA--- 188
            |:..|.|..|||.|:|.:|||:| |...|:.:..:.||                ||...|.|   
Mouse   296 VYTWLPIGTIIDNEILVIHGGIS-ESTDLNTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNY 359

  Fly   189 -----------------------FCDLVWSDPEDME-YWGQSPRGAGWLFGHNVTKDFMAINNLN 229
                                   ..|::||||...: .:..:.||.|..||.:||...::.|.|.
Mouse   360 VEPRKVEPDKTPSEDLTKQEWEQIVDILWSDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLK 424

  Fly   230 LICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAI--LSFET 274
            ::.|:|:...:|.:...|||::||:||.||.....|..|.  ||:.|
Mouse   425 MLIRSHECKPDGYEVSHDGKVITVFSASNYYEEGSNRGAYIRLSYGT 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 99/307 (32%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 99/307 (32%)
Ppef1XP_011246120.1 MPP_RdgC 144..479 CDD:277364 99/307 (32%)
PTZ00183 518..660 CDD:185503
EF-hand_7 595..663 CDD:372618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.