DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Y40H4A.2

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_506609.2 Gene:Y40H4A.2 / 189799 WormBaseID:WBGene00012741 Length:333 Species:Caenorhabditis elegans


Alignment Length:243 Identity:99/243 - (40%)
Similarity:136/243 - (55%) Gaps:9/243 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLR 109
            ||.:.||:||.|.||.::|...|....::|:|:||:||||...:||...|:.....||..:.|.|
 Worm    79 PVHIVGDLHGHFGDLRRIFGIHGAPGISHYVFLGDYVDRGRQGIETVMLLMAYHCLYPDHLFLCR 143

  Fly   110 GNHETRQITKVYGFFDECFSKYGNAN--GWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLD 172
            ||||....|..|||||||..|||...  .|.:....|:.|.:||:|.::|||:|||:||.|..|:
 Worm   144 GNHEDYNTTMTYGFFDECRMKYGKKGTLAWLHIINAFNHLPLAALILDKVLCMHGGISPHIQKLE 208

  Fly   173 QIRTIDRNGEIPYKGAFCDLVWSDPEDMEY--WGQSPRGAGWLFGHNVTKDFMAINNLNLICRAH 235
            .|..|.|...||..|..|||||||||....  |..|.||..:.|.....:.|...|.|:||.|||
 Worm   209 DIDKIQRPTFIPSYGLACDLVWSDPEKTSNVGWSLSARGISFSFDDITIEKFCQDNGLDLIVRAH 273

  Fly   236 QLVNE----GIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFETAEKRQ 279
            |:.:|    |.|:..:|::||::||.|| ...||.:.::..:..:..|
 Worm   274 QISSEMIRGGHKWHANGRMVTIFSAANY-LSMGNDSCVIRIDEQKTMQ 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 99/243 (41%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 99/243 (41%)
Y40H4A.2NP_506609.2 PP2Ac 49..328 CDD:197547 99/243 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.