DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and R08A2.2

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_506632.2 Gene:R08A2.2 / 187692 WormBaseID:WBGene00011133 Length:371 Species:Caenorhabditis elegans


Alignment Length:269 Identity:89/269 - (33%)
Similarity:136/269 - (50%) Gaps:20/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPS 103
            :|.|..|:|:.||||||...|.:.|...|..|...::|:||:||||..|.|....|...|.|||.
 Worm    58 MLQVEHPITIVGDIHGQLDALIRYFDAVGYPPKVKFLFLGDYVDRGAKSFEVSLLLFCYKIRYPH 122

  Fly   104 RITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEI 168
            .:.|||||||..::.::|||::|...|.| ...|:....||:.|.:.|.:.:.:||:|||:|...
 Worm   123 SVHLLRGNHECMKMNRLYGFYEELARKRG-GRMWRQYQNVFNELPLCARVGQRILCMHGGISQNC 186

  Fly   169 ITLDQIRTIDRNGEIPY---KGAFCDLVWSDPEDME---YWGQSPRGAGWLFGHNVTKDFMAINN 227
            .:.:..:.: :....|.   :|...||:|:||...:   :.....|....:||......|:....
 Worm   187 NSWESFKAL-KKPNTPLTCDEGLQVDLMWADPTQDKCNTFAMNKQRAISVVFGEKGLDVFLKKLG 250

  Fly   228 LNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAI--------LSFETAEKRQTKIFL 284
            |:||.|||::..||..::|:.|.|||:|||.||....|..||        :||.....|    .:
 Worm   251 LSLIVRAHEVSQEGFNFLFNKKCVTVFSAPYYCGNDTNCGAIMHVSESYEISFTVLRPR----MI 311

  Fly   285 AVPDAERVI 293
            |.|:...::
 Worm   312 ATPENIEIV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 89/269 (33%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 88/261 (34%)
R08A2.2NP_506632.2 PP2Ac 36..308 CDD:197547 86/251 (34%)
MPP_PPP_family 66..295 CDD:277316 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.