DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and F44B9.9

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:263 Identity:74/263 - (28%)
Similarity:110/263 - (41%) Gaps:74/263 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHT----------- 72
            :.||..|.:||.::..:|..:..:|.|||:.|||||||.||.:|..|.....:.           
 Worm     6 KTELFCLLDMVIELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGFSTK 70

  Fly    73 NYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGW 137
            .::|:||:|||||.||:....:.:||..:|.:..|||||||||.|...|||              
 Worm    71 KWVFLGDYVDRGYKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF-------------- 121

  Fly   138 KYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDPEDMEY 202
            :.|                          .::.|          :||.|.:|.            
 Worm   122 RVC--------------------------SVVVL----------KIPAKPSFI------------ 138

  Fly   203 WGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVA 267
             ..:.||....|......:...:.|::||.|.||::..|.|:..|.||.|::|||.|.....|..
 Worm   139 -RNNKRGLSVCFNEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEIDNSG 202

  Fly   268 AIL 270
            |::
 Worm   203 AVM 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 74/263 (28%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 74/263 (28%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 74/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.