DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and C27B7.6

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_501547.3 Gene:C27B7.6 / 182956 WormBaseID:WBGene00007763 Length:454 Species:Caenorhabditis elegans


Alignment Length:264 Identity:92/264 - (34%)
Similarity:150/264 - (56%) Gaps:7/264 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ENELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTNYIFMGDFVDR 83
            ::::.::.:.:.:||.....::.:..||.|.||||||..||.|.....|:.|...|:|:||:|||
 Worm    33 DSDILEVLKTIKEILEPLPCLIEIIAPVVVFGDIHGQLGDLLQFTNEVGRPPDFQYLFLGDYVDR 97

  Fly    84 GYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYCCKVFDLLT 148
            |..|||....|..:|..:..::.|||||||.|::..:|||.:|...| .|::.||....||..|:
 Worm    98 GPNSLEVTVWLFCMKILFSKKVHLLRGNHEVRRVNTMYGFKEEMMRK-RNSHLWKVFNDVFAELS 161

  Fly   149 IAAIIDEEVLCVHGGLSPEIITLDQIRTIDR---NGEIPYKGAFCDLVWSDP--EDMEYWGQSPR 208
            |.|.|:.::||:|||:||:|.:.|.:..:.:   :|:..: |...||:||||  :|........|
 Worm   162 ICASINRKILCMHGGISPKIESWDSLTGMTKPRVHGDCEH-GLIVDLIWSDPNRKDDTIQFNKMR 225

  Fly   209 GAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILSFE 273
            |...|||.:|..:......::||.|||::..:|..:.||.:|:||:|||.|.....|:.::.:..
 Worm   226 GISTLFGKSVVDNLCTTLAIDLIIRAHEMKEKGHTFEFDNRLLTVFSAPYYSGHNSNLGSVATIS 290

  Fly   274 TAEK 277
            .:.|
 Worm   291 KSLK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 92/264 (35%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 92/264 (35%)
C27B7.6NP_501547.3 PP2Ac 31..304 CDD:197547 92/264 (35%)
MPP_PPP_family 61..289 CDD:277316 87/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.