DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and pph-5

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001367002.1 Gene:pph-5 / 180263 WormBaseID:WBGene00012665 Length:496 Species:Caenorhabditis elegans


Alignment Length:290 Identity:107/290 - (36%)
Similarity:152/290 - (52%) Gaps:41/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NELKKLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQVPHTN-YIFMGDFVDR 83
            |.:|.|..||     |.|  :|.....|:|||:|||||||..:|...|....|| |:|.||||||
 Worm   217 NYVKSLPTMV-----EIT--VPTGKKFTICGDVHGQFYDLCNIFEINGYPSETNPYLFNGDFVDR 274

  Fly    84 GYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNANGWKYC---CKVFD 145
            |.:|:||...::..|..||:...:.|||||:..:.|:|||..|..:||..    :.|   .:.|.
 Worm   275 GSFSVETIFTMIGFKLLYPNHFFMSRGNHESDVMNKMYGFEGEVKAKYTQ----QMCDMFTETFC 335

  Fly   146 LLTIAAIIDEEVLCVHGGLSPEI-ITLDQIRTIDRNGEIPYKGAFCDLVWSDPEDMEYWGQSP-- 207
            .|.:..:|:|::...||||..|. :||:.||..|||.:.|.:|..|||:||||:.:.  |:||  
 Worm   336 WLPLCHLINEKIFVCHGGLFKEDGVTLEDIRKTDRNRQPPDEGIMCDLLWSDPQPIN--GRSPSK 398

  Fly   208 RGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGKLVTVWSAPNYCYRCGNVAAILSF 272
            ||.|..||.:||..:...|.:..:.|:|::..||.:...:|:..||:||||||.:..|..|.:: 
 Worm   399 RGVGCQFGPDVTSKWCETNGIEYVVRSHEVKPEGYEMHHNGQCFTVFSAPNYCDQMNNKGAFIT- 462

  Fly   273 ETAEKRQTKIFLAVPDAERVIPKQNTTPYF 302
                                |...|.||.|
 Worm   463 --------------------ITGDNLTPRF 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 107/290 (37%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 102/273 (37%)
pph-5NP_001367002.1 PLN03088 29..>139 CDD:215568
TPR repeat 33..57 CDD:276809
TPR repeat 62..91 CDD:276809
TPR repeat 96..124 CDD:276809
MPP_PP5_C 176..490 CDD:277362 107/290 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.