DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and W03D8.2

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001249242.1 Gene:W03D8.2 / 171844 WormBaseID:WBGene00020985 Length:364 Species:Caenorhabditis elegans


Alignment Length:311 Identity:109/311 - (35%)
Similarity:161/311 - (51%) Gaps:38/311 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EDVKKCKYL----PENELKKLCEMVCDILLEETNILPVST-PVTVCGDIHGQFYDLEQLFRTGGQ 68
            ||.:|...|    ..:|:.:|.:.:....||:..:|.:|. |:||..|:|||...|.::|.|...
 Worm    35 EDNEKVNQLRVDITISEISQLTDKMKKAFLEQPALLEISNEPITVVADMHGQSIHLLRIFLTNEA 99

  Fly    69 VPHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGN 133
            .|:..|:|:||:||||..|:.....|..:|.|||..:.|||||||....|..|||:|||..::.|
 Worm   100 PPNQKYLFLGDYVDRGSQSVVVMCLLFCMKHRYPQHVFLLRGNHEDVNTTLNYGFYDECLEQWKN 164

  Fly   134 ANG---WKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWS 195
            ..|   |:.....|:.:.:||:|..:|.|.|||:||.:.:|:.|.:|:|...:|..|..|||:||
 Worm   165 DEGEKVWRMFIDTFNCMPLAAVIGGKVFCAHGGISPWLESLEDINSIERPLVVPPYGLACDLLWS 229

  Fly   196 DPEDMEY--WGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNE----GIKYMFDGKLVTVW 254
            ||...|.  ||.|.||..:.:|.:|.::|.|.|::.|:.|.|||..|    |....|.|:|::::
 Worm   230 DPAQPERNGWGLSHRGISFTYGKSVVEEFCAKNDIALVIRGHQLFKEMYPQGCVLRFGGRLISLF 294

  Fly   255 SAPNY------------------------CYRCGNVAAILSFETAEKRQTK 281
            ||.||                        .|||.:.|.:.|.|....|..|
 Worm   295 SALNYEGHKNNSSVLKLEFVGQRVKVKQVLYRCRHYAPLRSNEYLGFRDMK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 109/311 (35%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 109/311 (35%)
W03D8.2NP_001249242.1 MPP_superfamily 45..306 CDD:301300 97/260 (37%)
PP2Ac 47..312 CDD:197547 97/264 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.