DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpV and Ppp3cc

DIOPT Version :9

Sequence 1:NP_001259272.1 Gene:PpV / 31582 FlyBaseID:FBgn0003139 Length:303 Species:Drosophila melanogaster
Sequence 2:XP_008769035.1 Gene:Ppp3cc / 171378 RGDID:621616 Length:515 Species:Rattus norvegicus


Alignment Length:283 Identity:114/283 - (40%)
Similarity:162/283 - (57%) Gaps:20/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DVKKCKYLPENELK-----KLCEMVCDILLEETNILPVSTPVTVCGDIHGQFYDLEQLFRTGGQV 69
            ||.|...:.|..::     |:......||.:|..:|.|..|:|||||:||||:||.:||..||..
  Rat    40 DVLKNHLVKEGRVEEDVALKIINDGAAILKQEKTMLEVEAPITVCGDVHGQFFDLMKLFEVGGSP 104

  Fly    70 PHTNYIFMGDFVDRGYYSLETFTRLLTLKARYPSRITLLRGNHETRQITKVYGFFDECFSKYGNA 134
            .:|.|:|:||:|||||:|:|....|.:||..:|..:.|||||||.|.:|:.:.|..||..||...
  Rat   105 SNTRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEL 169

  Fly   135 NGWKYCCKVFDLLTIAAIIDEEVLCVHGGLSPEIITLDQIRTIDRNGEIPYKGAFCDLVWSDP-E 198
             .::.|...||.|.:||:::::.||||||:||||..||.||.:||..|.|..|..|||:|||| |
  Rat   170 -VYEACMHTFDCLPLAALLNQQFLCVHGGMSPEITCLDDIRKLDRFAEPPAFGPVCDLLWSDPLE 233

  Fly   199 DM-------EYWGQSPRGAGWLFGHNVTKDFMAINNLNLICRAHQLVNEGIKYMFDGK------L 250
            |.       .|...:.||..:.|.:....:|:..|:|..|.|||:..:.|.:.....:      |
  Rat   234 DYGSEKTLEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKNQATGFPSL 298

  Fly   251 VTVWSAPNYCYRCGNVAAILSFE 273
            :|::|||||.....|.||:|.:|
  Rat   299 ITIFSAPNYLDVYNNKAAVLKYE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpVNP_001259272.1 PTZ00239 3..303 CDD:173488 114/283 (40%)
MPP_PP2A_PP4_PP6 3..287 CDD:277360 114/283 (40%)
Ppp3ccXP_008769035.1 MPP_PP2B 37..341 CDD:277361 114/283 (40%)
PP2Ac 54..325 CDD:197547 110/269 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.