DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kdn and AT2G11270

DIOPT Version :9

Sequence 1:NP_727091.1 Gene:kdn / 31579 FlyBaseID:FBgn0261955 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001318210.1 Gene:AT2G11270 / 815597 AraportID:AT2G11270 Length:83 Species:Arabidopsis thaliana


Alignment Length:34 Identity:15/34 - (44%)
Similarity:22/34 - (64%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 QERVKNFRKQHGATKMGETTIDMMYGGMRGIKAL 137
            |:|.|..:.:||...:|..|:||:.|||||:..|
plant    43 QDRSKKLKLKHGKVPVGNITVDMVLGGMRGMTGL 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kdnNP_727091.1 PLN02456 89..513 CDD:215250 15/34 (44%)
ScCit1-2_like 92..519 CDD:99858 15/34 (44%)
AT2G11270NP_001318210.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0372
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131452at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.