powered by:
Protein Alignment kdn and AT2G11270
DIOPT Version :9
Sequence 1: | NP_727091.1 |
Gene: | kdn / 31579 |
FlyBaseID: | FBgn0261955 |
Length: | 522 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001318210.1 |
Gene: | AT2G11270 / 815597 |
AraportID: | AT2G11270 |
Length: | 83 |
Species: | Arabidopsis thaliana |
Alignment Length: | 34 |
Identity: | 15/34 - (44%) |
Similarity: | 22/34 - (64%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 QERVKNFRKQHGATKMGETTIDMMYGGMRGIKAL 137
|:|.|..:.:||...:|..|:||:.|||||:..|
plant 43 QDRSKKLKLKHGKVPVGNITVDMVLGGMRGMTGL 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0372 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1131452at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.