DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B16.6 and AT2G33220

DIOPT Version :9

Sequence 1:NP_001284943.1 Gene:ND-B16.6 / 31578 FlyBaseID:FBgn0029868 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001324708.1 Gene:AT2G33220 / 817884 AraportID:AT2G33220 Length:174 Species:Arabidopsis thaliana


Alignment Length:111 Identity:39/111 - (35%)
Similarity:65/111 - (58%) Gaps:6/111 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AVPHCPPKQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVT-AVGLGIYYL-TAKKVKRD-E 65
            :|...|..||.|||||:..:.:||   :...||.:.:..::.|: |...|:|.: ...|::|. :
plant    14 SVKDMPLLQDGPPPGGFAPVRYAR---RISNTGPSAMAIFLTVSGAFAWGMYQVGQGNKIRRALK 75

  Fly    66 IEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVG 111
            .|..:|:..|.|||.||.|..|:.:.::..:.||::||:||||:||
plant    76 EEKYAARRAILPILQAEEDERFVSEWKKYLEYEADVMKDVPGWKVG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B16.6NP_001284943.1 GRIM-19 9..140 CDD:283794 38/106 (36%)
AT2G33220NP_001324708.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I3758
eggNOG 1 0.900 - - E1_KOG3300
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I2517
OMA 1 1.010 - - QHG58109
OrthoDB 1 1.010 - - D1496781at2759
OrthoFinder 1 1.000 - - FOG0005230
OrthoInspector 1 1.000 - - otm3295
orthoMCL 1 0.900 - - OOG6_103668
Panther 1 1.100 - - LDO PTHR12966
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3750
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.