DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B16.6 and NDUFA13

DIOPT Version :9

Sequence 1:NP_001284943.1 Gene:ND-B16.6 / 31578 FlyBaseID:FBgn0029868 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_057049.5 Gene:NDUFA13 / 51079 HGNCID:17194 Length:144 Species:Homo sapiens


Alignment Length:150 Identity:53/150 - (35%)
Similarity:78/150 - (52%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVGLG--IY-YLTAKKVKRD----EIEM 68
            |||:||||||..|.:.|..|:...:|::.:       |:|:|  || :.:..|..|:    :||.
Human     7 KQDMPPPGGYGPIDYKRNLPRRGLSGYSML-------AIGIGTLIYGHWSIMKWNRERRRLQIED 64

  Fly    69 RSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVGTWYGEPVFKTLPEDTLVTPIFK 133
            ..|:..:.|:|.||.||..|:.||.|.:|||.:||:||.|:|    ||.||.|   ...|.|:..
Human    65 FEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKV----GESVFHT---TRWVPPLIG 122

  Fly   134 EFYAHSDWKSYAKRAHLKLW 153
            |.|.....:.....:|..:|
Human   123 ELYGLRTTEEALHASHGFMW 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B16.6NP_001284943.1 GRIM-19 9..140 CDD:283794 51/135 (38%)
NDUFA13NP_057049.5 GRIM-19 5..128 CDD:310657 51/134 (38%)
Important for inducing cell death 102..144 13/47 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142565
Domainoid 1 1.000 75 1.000 Domainoid score I9095
eggNOG 1 0.900 - - E1_KOG3300
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5258
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58109
OrthoDB 1 1.010 - - D1496781at2759
OrthoFinder 1 1.000 - - FOG0005230
OrthoInspector 1 1.000 - - oto90842
orthoMCL 1 0.900 - - OOG6_103668
Panther 1 1.100 - - LDO PTHR12966
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3539
SonicParanoid 1 1.000 - - X3750
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.