DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B16.6 and ndufa13

DIOPT Version :9

Sequence 1:NP_001284943.1 Gene:ND-B16.6 / 31578 FlyBaseID:FBgn0029868 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_988900.1 Gene:ndufa13 / 394495 XenbaseID:XB-GENE-5961869 Length:144 Species:Xenopus tropicalis


Alignment Length:126 Identity:47/126 - (37%)
Similarity:67/126 - (53%) Gaps:7/126 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVGLGIYYLTAKKVKRDEIEMRSAQNVI 75
            ||||||||||..:.:.|..|:...:|::.......|...|....:...::.:|.:||....:..:
 Frog     7 KQDLPPPGGYGPVDYKRNLPRRGLSGYSMFALGAGVMLFGYWSIFRWNRERRRLQIEDLETRVAL 71

  Fly    76 FPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVGTWYGEPVFKTLPEDTLVTPIFKEFY 136
            .|:..||.||..||.:::|.:|||.|||:||||:|    ||..|.|   |..|||...|.|
 Frog    72 LPLFQAEADRRILRLMQQNLEEEAILMKDVPGWKV----GESTFHT---DRWVTPTLNELY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B16.6NP_001284943.1 GRIM-19 9..140 CDD:283794 47/126 (37%)
ndufa13NP_988900.1 GRIM-19 5..129 CDD:368791 47/126 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8418
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5046
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1496781at2759
OrthoFinder 1 1.000 - - FOG0005230
OrthoInspector 1 1.000 - - oto104631
Panther 1 1.100 - - LDO PTHR12966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3750
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.