DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B16.6 and ndufa13

DIOPT Version :9

Sequence 1:NP_001284943.1 Gene:ND-B16.6 / 31578 FlyBaseID:FBgn0029868 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_957008.1 Gene:ndufa13 / 393687 ZFINID:ZDB-GENE-040426-1672 Length:144 Species:Danio rerio


Alignment Length:133 Identity:50/133 - (37%)
Similarity:75/133 - (56%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVGLGI----YYLTA---KKVKRDEIEM 68
            |||:.|||||..:.:.|..||...:|::       :.|||:|:    |:...   ::.:|.:||.
Zfish     7 KQDMAPPGGYGPVDYKRNLPKRGLSGYS-------MFAVGIGVMMFGYWRLCRWNRERRRMQIED 64

  Fly    69 RSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVGTWYGEPVFKTLPEDTLVTPIFK 133
            ...:..:.|:|.||.||:.||.||.|.:|||.|||:||||:|    ||.:|.|   :..|:|:..
Zfish    65 LETRIALLPLLQAEHDRQTLRMLRENLEEEAILMKDVPGWKV----GENMFHT---ERWVSPVPD 122

  Fly   134 EFY 136
            |.|
Zfish   123 ELY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B16.6NP_001284943.1 GRIM-19 9..140 CDD:283794 50/133 (38%)
ndufa13NP_957008.1 GRIM-19 5..129 CDD:283794 50/133 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12350
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58109
OrthoDB 1 1.010 - - D1496781at2759
OrthoFinder 1 1.000 - - FOG0005230
OrthoInspector 1 1.000 - - oto38841
orthoMCL 1 0.900 - - OOG6_103668
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3750
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.