DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B16.6 and Ndufa13-ps1

DIOPT Version :9

Sequence 1:NP_001284943.1 Gene:ND-B16.6 / 31578 FlyBaseID:FBgn0029868 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_038936509.1 Gene:Ndufa13-ps1 / 314759 RGDID:1565358 Length:144 Species:Rattus norvegicus


Alignment Length:147 Identity:49/147 - (33%)
Similarity:75/147 - (51%) Gaps:33/147 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATAVPHCPPKQDLPPPGGYKKIPFAR-VPPKSYFTGFTTIGTYVVVTAVGLGIYYLTAKKVKR- 63
            ||:.|     |||:|||.||..|.:.| :|.:...:|::       :.|:|:|.......::.| 
  Rat     1 MASKV-----KQDMPPPRGYGPIDYKRNLPRRRGLSGYS-------MFALGIGALIFGYWRIMRW 53

  Fly    64 ---------DEIEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVGTWYGEPVF 119
                     :::|.|.|   :.|:|.||:||..|:.||.|.:|||.:||:||.|:|    ||.:|
  Rat    54 NRERRRLLIEDLEARIA---LMPLLQAEKDRRTLQILRENLEEEAIIMKDVPNWKV----GESMF 111

  Fly   120 KTLPEDTLVTPIFKEFY 136
            .|   ...|.|:..|.|
  Rat   112 HT---TRWVPPLIGELY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B16.6NP_001284943.1 GRIM-19 9..140 CDD:283794 46/139 (33%)
Ndufa13-ps1XP_038936509.1 GRIM-19 4..128 CDD:399311 47/144 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336066
Domainoid 1 1.000 72 1.000 Domainoid score I9127
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5202
OMA 1 1.010 - - QHG58109
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005230
OrthoInspector 1 1.000 - - otm45929
orthoMCL 1 0.900 - - OOG6_103668
Panther 1 1.100 - - O PTHR12966
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3750
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.