DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3847 and CG15710

DIOPT Version :9

Sequence 1:NP_572317.2 Gene:CG3847 / 31577 FlyBaseID:FBgn0029867 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_611122.1 Gene:CG15710 / 36832 FlyBaseID:FBgn0034120 Length:265 Species:Drosophila melanogaster


Alignment Length:267 Identity:84/267 - (31%)
Similarity:129/267 - (48%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 EELEDGE--EVEHDDEFVTVDHEGGELE-VEDDEVGSIVFESTIDHAEQDPYGRNKTFYCPNCGN 193
            ||||...  .::.|:..||..:....|: :::::|  .:.::|            :.|:||.|.|
  Fly    10 EELEPATLLSIQEDNGIVTKVYVAPCLQPIKEEKV--FLEDNT------------QRFHCPLCSN 60

  Fly   194 CYSAAGSLKLHMRACLRQRNEISTD-----ERKCKVCSKVFNSVAYLKEHMMRHTGEQPFR-CTR 252
            ....||:.|:|:.||.|:...:..|     :.:|.:|.|:|:||..|..|.:.|......| |..
  Fly    61 VIRTAGAYKVHLMACQRRLARMMKDVPDVSQHQCNICKKIFSSVDALIGHRLLHGSPSMNRTCAS 125

  Fly   253 CYRKFVEESKFTAHMESHKHQDKLEAEAVALAAQHGGKKVVVKEFQCAFCSQNFTVVFDVGQVKR 317
            |:.||..:.::..|:|||....:...|:      :.|...:.|.|.|.||...|...|..|||.|
  Fly   126 CHVKFGTDLEYRTHLESHLIPCESTDES------YEGAYTITKTFNCVFCRTEFKACFKPGQVTR 184

  Fly   318 RYACDACRDKYSNAEALRQHKQQVEEKR-------EFSCVRCGRKFVFEGFLQRHLPTCD--GSI 373
            |||||||         :.:.|.|.|||:       |..|.|||:|:.:||||.|||.||.  ...
  Fly   185 RYACDAC---------IVRLKAQEEEKKILGKRRPELICDRCGKKYKYEGFLHRHLKTCQMPDKC 240

  Fly   374 KRRRDMK 380
            ||:|:::
  Fly   241 KRKREIE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3847NP_572317.2 C2H2 Zn finger 188..216 CDD:275368 11/27 (41%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
C2H2 Zn finger 250..270 CDD:275368 6/19 (32%)
CG15710NP_611122.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442367
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C8ND
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.