DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3847 and Y37E11B.1

DIOPT Version :9

Sequence 1:NP_572317.2 Gene:CG3847 / 31577 FlyBaseID:FBgn0029867 Length:380 Species:Drosophila melanogaster
Sequence 2:NP_001023441.1 Gene:Y37E11B.1 / 177118 WormBaseID:WBGene00021374 Length:167 Species:Caenorhabditis elegans


Alignment Length:155 Identity:35/155 - (22%)
Similarity:58/155 - (37%) Gaps:47/155 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 STDERKCKVCSKVFNSVAYLKEHMMRH-TGEQPFRCTRCYRKFVEESKFTAHMESHKHQDKLEAE 279
            |.|..:|::|.::..|...|::|...| ..|:...|:.|.::|......      .|||      
 Worm     8 SRDAAQCEICGRILKSDESLRKHERIHDEAERKLECSTCQKRFHNAELL------RKHQ------ 60

  Fly   280 AVALAAQHGGKKVVVKEFQCAFCSQNFTVVFDVGQVKRRYACDACRDKYSNAEALRQHKQQVEEK 344
                                        :|.|:  .|:...|:.|..|||:..||.:||:..|..
 Worm    61 ----------------------------IVHDI--PKKSIICEVCGKKYSSKSALAKHKRTHETD 95

  Fly   345 REFSCVRCGRKF----VFEGFLQRH 365
            :.|:|..|...|    .|:..|::|
 Worm    96 KRFTCPMCYASFDLSDPFKIHLRKH 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3847NP_572317.2 C2H2 Zn finger 188..216 CDD:275368 35/155 (23%)
C2H2 Zn finger 222..242 CDD:275368 5/19 (26%)
C2H2 Zn finger 250..270 CDD:275368 3/19 (16%)
Y37E11B.1NP_001023441.1 C2H2 Zn finger 14..34 CDD:275368 5/19 (26%)
C2H2 Zn finger 43..63 CDD:275368 6/59 (10%)
C2H2 Zn finger 72..92 CDD:275368 9/19 (47%)
C2H2 Zn finger 100..120 CDD:275368 5/19 (26%)
C2H2 Zn finger 128..145 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.