DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and PBR1

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_014218.2 Gene:PBR1 / 855540 SGDID:S000005125 Length:407 Species:Saccharomyces cerevisiae


Alignment Length:376 Identity:91/376 - (24%)
Similarity:155/376 - (41%) Gaps:88/376 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PGSVPGTVFPPGFD--PTAESVEKTLCFRGFWAWAVLIFLIVLGILLFMWLLRKCIQGPAYRKAN 70
            |.::.||....|.|  |..::::|           |..:::..|.:.: |     .:||:.....
Yeast     2 PLNIIGTALLDGTDKIPYYQTIKK-----------VAPYVLATGAIKY-W-----SRGPSNTWER 49

  Fly    71 RIDGKVVIVTGCNT-GIGKETVLELAKRGARVYMACRDPGR-----CEAARLDIMDRSRNQQLFN 129
            ::.|||.:|||..: |:|.....::|:.||::.:..|:...     ||    ::.::::|:.:|.
Yeast    50 KLHGKVYLVTGATSQGMGTSVAYKMAELGAQLIILTREVDEWVTEWCE----ELREKTKNELIFV 110

  Fly   130 RTLDLGSLQSVRNFVERF--KAEESRLDILINNAGVM--------ACP-RTLTADGFEQQFGVNH 183
            ...||.:|..:|.|...:  .:...|||.:|..:|.|        :.| |..:.||.|.|...|:
Yeast   111 EKCDLSNLWEIRKFATSWLDNSPPRRLDGVIVMSGDMEPWGIPKISLPQRRSSKDGLELQIATNY 175

  Fly   184 LGHFLLTNLLLDRLKHSSPS---RIVVVSSAAHLFGRINRED-LMSEKNYSKFFGAYSQSKLANI 244
            :..|.|.|||....|...|.   ||::.:....:.|.||.|| |.....|......::.|||...
Yeast   176 VAIFHLLNLLQPSFKAQPPDRDVRIILATCWLQVVGDINIEDPLWQNAKYKSALKFFASSKLQLG 240

  Fly   245 LFTLKLSTILKD------------TG--VTVNCCHPGVVRTEINRHFSGPGWMKTALQKGS---- 291
            |..::|...|.:            ||  ||:....||.:|:..         ::..:..||    
Yeast   241 LSMMELQRRLTEDIKNQKTNGAERTGKNVTITMVQPGTMRSNS---------LRRVISNGSVVLL 296

  Fly   292 -------LY-----FFKTPKAGAQTQLRLALDPQLE-----GSTGGYYSDC 325
                   ||     |.|:.:.|.|:.|...:.|:||     .:...|.|||
Yeast   297 IILYCILLYPILWLFTKSGRRGDQSFLYALMTPELEEVNLKDTKVKYISDC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 75/303 (25%)
NADB_Rossmann 74..347 CDD:304358 79/308 (26%)
PBR1NP_014218.2 retinol-DH_like_SDR_c_like 53..367 CDD:212492 79/308 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.