DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and ERG27

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_013201.1 Gene:ERG27 / 850790 SGDID:S000004090 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:49/246 - (19%)
Similarity:81/246 - (32%) Gaps:67/246 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVVIVTGCNTGIGKETVLELAK------------------RGARVYMACRD----PGRCEAARLD 117
            ||.||||.|:.:|...|..|.:                  |...|....:|    .||.|...:|
Yeast     4 KVAIVTGTNSNLGLNIVFRLIETEDTNVRLTIVVTSRTLPRVQEVINQIKDFYNKSGRVEDLEID 68

  Fly   118 ----IMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAE----------------ESRLDILINNAG 162
                ::|.:....:.|...|:.......|::....|:                .:.|:.:.|...
Yeast    69 FDYLLVDFTNMVSVLNAYYDINKKYRAINYLFVNAAQGIFDGIDWIGAVKEVFTNPLEAVTNPTY 133

  Fly   163 VMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEK 227
            .:......:.|.....|..|..|.:...:.:|.:|.... :.||.:||            :||:.
Yeast   134 KIQLVGVKSKDDMGLIFQANVFGPYYFISKILPQLTRGK-AYIVWISS------------IMSDP 185

  Fly   228 NY--------SKFFGAYSQSKLANILFTLKLSTI--LKDTGVTVNCCHPGV 268
            .|        .|...:|..||  .::..|.|:|.  ||..|:......||:
Yeast   186 KYLSLNDIELLKTNASYEGSK--RLVDLLHLATYKDLKKLGINQYVVQPGI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 49/246 (20%)
NADB_Rossmann 74..347 CDD:304358 49/246 (20%)
ERG27NP_013201.1 3KS_SDR_c 3..293 CDD:187645 49/246 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4278
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.