DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and AT1G64590

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_176640.1 Gene:AT1G64590 / 842767 AraportID:AT1G64590 Length:334 Species:Arabidopsis thaliana


Alignment Length:305 Identity:111/305 - (36%)
Similarity:151/305 - (49%) Gaps:47/305 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRN 142
            |:||..:|||.||...|||||||:.:..|.....|..:..|:....:.::....|||.||.|||.
plant    38 IITGATSGIGAETARVLAKRGARLVLPARSVKTAEETKARILSEFPDAEIIVMHLDLSSLTSVRR 102

  Fly   143 FVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSS-----P 202
            ||:.|::....|:|||||||..|....|:.||.|..|..|:|||||||.|||.::..::     .
plant   103 FVDDFESLNLPLNILINNAGKYAHKHALSEDGVEMTFATNYLGHFLLTKLLLKKMIETAAQTGVQ 167

  Fly   203 SRIVVVSSAAH---------LFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTIL--KD 256
            .|||.|:|..|         ....|:|    :.:||.. ..||:.|||||:|.|::||.:|  .|
plant   168 GRIVNVTSVVHSWFSGDMLQYLADISR----NNRNYDA-TRAYALSKLANVLHTVELSRLLHKMD 227

  Fly   257 TGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFFKTPK------AGAQTQLRLALDPQLE 315
            ..||.||.|||:|:|.:.|...|   :.|     .|.||.|.|      ..|.|...:|..|:|.
plant   228 ANVTANCVHPGIVKTRLTRDREG---VVT-----DLVFFLTSKLLKSVPQAAATTCYVATSPRLR 284

  Fly   316 GSTGGYYSDCMRWPLFPWVRNMQT------ADWLWRESEKLLGLP 354
            ...|.|:|||..      .|:.::      |..||..|:.|:..|
plant   285 NVCGKYFSDCNE------ARSSKSGSCNLKAQRLWTASDLLVSPP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 99/262 (38%)
NADB_Rossmann 74..347 CDD:304358 108/296 (36%)
AT1G64590NP_176640.1 retinol-DH_like_SDR_c_like 36..313 CDD:212492 106/293 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.