DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and AT4G24050

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_194136.1 Gene:AT4G24050 / 828505 AraportID:AT4G24050 Length:332 Species:Arabidopsis thaliana


Alignment Length:297 Identity:112/297 - (37%)
Similarity:154/297 - (51%) Gaps:37/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRN 142
            ::||..:|||.||...|||||||:....|:....|.|:..|:......::....|||.|:.||||
plant    38 VITGATSGIGAETARVLAKRGARLIFPARNVKAAEEAKERIVSEFPETEIVVMKLDLSSIASVRN 102

  Fly   143 FVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSS-----P 202
            ||..|::.:..|::||||||.:|....::.||.|..|..|:|||||||||||:::..::     .
plant   103 FVADFESLDLPLNLLINNAGKLAHEHAISEDGIEMTFATNYLGHFLLTNLLLNKMIQTAEETGVQ 167

  Fly   203 SRIVVVSSAAHLFGRINREDLMSEKNYSKFFG----------AYSQSKLANILFTLKLSTILKDT 257
            .|||.|:|..|  |..: .||:   .|.:...          ||:.|||||:|.|.:||:.|:..
plant   168 GRIVNVTSGIH--GWFS-GDLI---EYLRLISQPKCQFDATRAYALSKLANVLHTKELSSRLQKI 226

  Fly   258 G--VTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFF------KTPKAGAQTQLRLALDPQL 314
            |  |||||.|||||||.:.|...|   :.|     .|.||      ||....|.|...:|.:|:|
plant   227 GANVTVNCVHPGVVRTRLTRDREG---LLT-----DLVFFLASKLVKTVPQAAATTCYVATNPRL 283

  Fly   315 EGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLL 351
            ...:|.|::||..........|...|..||..||.|:
plant   284 VNVSGKYFTDCNETTPSGLGTNSSEATKLWAASEILV 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 101/263 (38%)
NADB_Rossmann 74..347 CDD:304358 109/291 (37%)
AT4G24050NP_194136.1 PRK06197 36..319 CDD:235737 111/294 (38%)
retinol-DH_like_SDR_c_like 36..313 CDD:212492 107/288 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.