DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and Tic32-IVa

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_849428.1 Gene:Tic32-IVa / 828442 AraportID:AT4G23430 Length:322 Species:Arabidopsis thaliana


Alignment Length:326 Identity:121/326 - (37%)
Similarity:166/326 - (50%) Gaps:52/326 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GKVVIVTGCNTGIGKETVLELAKRGARVYMACR--DPG---------RCEAARLDIMDRSRNQQL 127
            |...||||.::|||.||...|:.||..|.||.|  |.|         :...|:||:|:       
plant    29 GLTAIVTGASSGIGVETARVLSLRGVHVVMAVRNTDSGAKVKEDIVKQVPGAKLDVME------- 86

  Fly   128 FNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNL 192
                |||.|:||||.|...:|:....|::||||||:||||..|:.|..|.||..|||||||||.|
plant    87 ----LDLSSMQSVRKFASEYKSTGLPLNLLINNAGIMACPFMLSKDNIELQFATNHLGHFLLTKL 147

  Fly   193 LLDRLKHSS-----PSRIVVVSSAAHLFGRIN--REDLMSEKNYSKFFGAYSQSKLANILFTLKL 250
            |||.:|.:|     ..|||.:||.||.|....  |.|.:::|:......||.||||.|:|...:|
plant   148 LLDTMKSTSRESKREGRIVNLSSEAHRFSYPEGVRFDKINDKSSYSSMRAYGQSKLCNVLHANEL 212

  Fly   251 STILKDTGV--TVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQ 313
            :..||:.||  |.|..|||.:.|.:.|:|:  .::..|:...:.|..|:...||.|...:||:||
plant   213 TKQLKEDGVNITANSLHPGAIMTNLGRYFN--PYLAVAVGAVAKYILKSVPQGAATTCYVALNPQ 275

  Fly   314 LEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGLPPLEPPPPVQSPTQNGNGTQNGNGS 378
            :.|.:|.|:.|.......|.|::.:.|..:|..|.||                   ..:|:|..|
plant   276 VAGVSGEYFQDSNIAKPLPLVKDTELAKKVWDFSTKL-------------------TDSQSGESS 321

  Fly   379 S 379
            |
plant   322 S 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 107/264 (41%)
NADB_Rossmann 74..347 CDD:304358 114/292 (39%)
Tic32-IVaNP_849428.1 retinol-DH_like_SDR_c_like 29..306 CDD:212492 113/289 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I1212
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.