DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and AT2G37540

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_181290.1 Gene:AT2G37540 / 818330 AraportID:AT2G37540 Length:321 Species:Arabidopsis thaliana


Alignment Length:282 Identity:115/282 - (40%)
Similarity:156/282 - (55%) Gaps:24/282 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRN 142
            |:||..:|||.|....||.|||.|.:|.|:|.....::..|:..:.|.::....:|:.|::|||:
plant    37 IITGGTSGIGLEAARVLAMRGAHVIIAARNPKAANESKEMILQMNPNARVDYLQIDVSSIKSVRS 101

  Fly   143 FVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSS-----P 202
            ||::|.|....|:|||||||||.||..||.||.|.||..||:|||||||||||::|.::     .
plant   102 FVDQFLALNVPLNILINNAGVMFCPFKLTEDGIESQFATNHIGHFLLTNLLLDKMKSTARESGVQ 166

  Fly   203 SRIVVVSSAAHL--------FGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTGV 259
            .|||.:||.||.        |..||.....||:.      ||.||||:|:|.:..||..|::.||
plant   167 GRIVNLSSIAHTYTYSEGIKFQGINDPAGYSERR------AYGQSKLSNLLHSNALSRRLQEEGV 225

  Fly   260 --TVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGSTGGYY 322
              |:|..|||:|.|.:.|:   .|:.....:..:..|:|....||.|...:||.|.|||.||.|:
plant   226 NITINSVHPGLVTTNLFRY---SGFSMKVFRAMTFLFWKNIPQGAATTCYVALHPDLEGVTGKYF 287

  Fly   323 SDCMRWPLFPWVRNMQTADWLW 344
            .||.......:..|...||.||
plant   288 GDCNIVAPSKFATNNSLADKLW 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 105/255 (41%)
NADB_Rossmann 74..347 CDD:304358 115/282 (41%)
AT2G37540NP_181290.1 retinol-DH_like_SDR_c_like 35..309 CDD:212492 113/280 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 171 1.000 Domainoid score I1148
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 219 1.000 Inparanoid score I1212
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D921996at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.