DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and Wwox

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_062519.2 Gene:Wwox / 80707 MGIID:1931237 Length:414 Species:Mus musculus


Alignment Length:295 Identity:120/295 - (40%)
Similarity:164/295 - (55%) Gaps:20/295 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQ 138
            ||||:|||.|:|||.||....|..||.|.:|||:..|...|...|::.....::...||||..|:
Mouse   124 GKVVLVTGANSGIGFETAKSFALHGAHVILACRNLSRASEAVSRILEEWHKAKVEAMTLDLAVLR 188

  Fly   139 SVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPS 203
            ||::|.|.|||:...|.:|:.|||..|.|..||.||.|..|.|||||||.|..||.|.|..|||:
Mouse   189 SVQHFAEAFKAKNVSLHVLVCNAGTFALPWGLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSSPA 253

  Fly   204 RIVVVSSAAHLFGRINREDLMSEKNYSKF---------FGAYSQSKLANILFTLKLSTILKDTGV 259
            |::||||.:|.|..||  |...:.:.|:.         ..||::|||.||||:.:|...|...||
Mouse   254 RVIVVSSESHRFTDIN--DSSGKLDLSRLSPPRSDYWAMLAYNRSKLCNILFSNELHRRLSPRGV 316

  Fly   260 TVNCCHPG-VVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGSTGGYYS 323
            |.|..||| ::.:.|:|:    .|:...|...:..|.|:.:.||.|.:..|:.|:|||..|.|::
Mouse   317 TSNAVHPGNMMYSAIHRN----SWVYKLLFTLARPFTKSMQQGAATTVYCAVAPELEGLGGMYFN 377

  Fly   324 DCMRWPLFPWVRNMQTADWLWRESEKL----LGLP 354
            :|.|.......::.:||..||..||:|    ||.|
Mouse   378 NCCRCLPSEEAQSEETARALWELSERLIQDRLGSP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 106/254 (42%)
NADB_Rossmann 74..347 CDD:304358 114/282 (40%)
WwoxNP_062519.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
WW 19..47 CDD:238122
Nuclear localization signal 50..55
WW 60..90 CDD:238122
PRK06196 107..404 CDD:235736 116/285 (41%)
human_WWOX_like_SDR_c-like 124..407 CDD:187669 117/288 (41%)
Interaction with MAPT. /evidence=ECO:0000269|PubMed:15126504 125..414 119/294 (40%)
Mediates targeting to the mitochondria 209..273 36/65 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.