DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and si:dkey-174n20.1

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_005165244.1 Gene:si:dkey-174n20.1 / 796174 ZFINID:ZDB-GENE-030131-7890 Length:308 Species:Danio rerio


Alignment Length:320 Identity:134/320 - (41%)
Similarity:192/320 - (60%) Gaps:23/320 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LIFLIVLGILLFM---WLLRK--CIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARV 101
            |::.|:..::.|:   |:.|:  |..      ..|:|||.|::||.|:||||||.:.||.|||||
Zfish     3 LLYTIISALVCFLVLKWMKRRRYCTD------LKRLDGKTVLITGGNSGIGKETAVALAMRGARV 61

  Fly   102 YMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMAC 166
            .:||||..:...|..:|..||.|..:.:..:||.:::|:|.|.:.|..:|.||||||||||:   
Zfish    62 IIACRDEEKARKAVREIKARSHNMNVLHMEVDLANMRSIREFSKTFLQKEKRLDILINNAGM--- 123

  Fly   167 PRTL--TADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNY 229
            |..|  |.|.|...||||||||||||||||.|||.|||||::.::.:::.:.::|.:||    ||
Zfish   124 PGVLDWTDDNFSMCFGVNHLGHFLLTNLLLPRLKESSPSRVINLTCSSYKYQKLNFQDL----NY 184

  Fly   230 SKF-FGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLY 293
            :.| |..|.:||||||.||.:|:.:::..|||....|||.||:....|||  ...:...|.....
Zfish   185 NLFPFFTYCRSKLANIYFTQELARMMEGKGVTAYAVHPGYVRSRWTCHFS--VLYQILAQVVMFM 247

  Fly   294 FFKTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGL 353
            ||.:.:|||||.:..|:..::....|||::||...||..:.|:...|..||..||:|:.|
Zfish   248 FFVSCEAGAQTVVYCAVSDEVLPRNGGYFTDCRPAPLKAFARDSGVAKKLWEASERLVKL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 113/250 (45%)
NADB_Rossmann 74..347 CDD:304358 122/275 (44%)
si:dkey-174n20.1XP_005165244.1 PRK06197 28..304 CDD:235737 126/290 (43%)
NADB_Rossmann 34..301 CDD:304358 122/275 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.