DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and 1700003E16Rik

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_082224.1 Gene:1700003E16Rik / 71837 MGIID:1919087 Length:598 Species:Mus musculus


Alignment Length:128 Identity:34/128 - (26%)
Similarity:49/128 - (38%) Gaps:28/128 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 GWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPL-FPWVRNMQTADWLW 344
            ||.:.|.|.|.|:..:| :...|.|..:.:.| ||..:|        ||| .|.|.. .|:..||
Mouse   463 GWEREAEQLGELWAGRT-RVPPQGQEPVEVTP-LEEDSG--------WPLAAPQVLE-ATSQVLW 516

  Fly   345 R-----ESEKLLGLPPLEPPPPVQSPTQNGNGTQNGNGSSSASASASSNNPASREMQSVETVV 402
            :     |:.||           |...:....|||.....:.....|....|.:.|.|.::|.|
Mouse   517 KPMVISETMKL-----------VPGVSMWNRGTQELLNPAVIRKEAEEGTPQAPEQQPIQTGV 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 12/37 (32%)
NADB_Rossmann 74..347 CDD:304358 21/71 (30%)
1700003E16RikNP_082224.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
DUF4639 6..571 CDD:292118 34/128 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 366..396
LamG <436..>463 CDD:304605 34/128 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 551..571 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.