DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and dhrs12la

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_987120.1 Gene:dhrs12la / 677747 ZFINID:ZDB-GENE-030131-8104 Length:320 Species:Danio rerio


Alignment Length:283 Identity:83/283 - (29%)
Similarity:135/283 - (47%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQ 138
            |:..::||.|:||||...:.:||:|..|:|.||:..:.|.||.:|:..|.|::::...|||...:
Zfish    40 GRSFMITGANSGIGKAAAMAIAKKGGTVHMVCRNKDKAEEARAEIVKESGNKEIYVHILDLSETK 104

  Fly   139 SVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPS 203
            .|..|||.||.:...|::||||||.|...|.:..:|.|:.|..|.|..|:....|:..|:.|...
Zfish   105 KVWEFVESFKKKYKTLNVLINNAGCMMTKREVNGEGLEKSFASNSLAVFIFIKSLIPLLEKSPDP 169

  Fly   204 RIVVVSSAAHLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGV 268
            |::.|||...|..::...:|.|::........|:|:|...::.|.:.:.           .||.:
Zfish   170 RVITVSSGGMLVQKLRTGNLQSQRGRYDGTMVYAQNKRQQVVMTEQFAK-----------AHPSI 223

  Fly   269 VRTEINRHFS--GPGWMKTALQKGSLYFF--------KTPKAGAQTQLRLAL-DPQLEGSTGGYY 322
                   |||  .|||:.|.....::..|        :|.:.||.|.:.||: :...:..:|.:|
Zfish   224 -------HFSVMHPGWVDTPTIANAMPDFHSSMKERLRTTEQGADTVVWLAVSEAAAKNPSGRFY 281

  Fly   323 SD----CMRWPLFPWVRNMQTAD 341
            .|    ....|| .|..:.|..|
Zfish   282 QDRKMVSAHLPL-AWTHSSQLED 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 75/255 (29%)
NADB_Rossmann 74..347 CDD:304358 83/283 (29%)
dhrs12laNP_987120.1 FabG 37..273 CDD:223959 75/250 (30%)
DHRS-12_like_SDR_c-like 40..294 CDD:187668 80/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.