DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and RDH14

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_065956.1 Gene:RDH14 / 57665 HGNCID:19979 Length:336 Species:Homo sapiens


Alignment Length:319 Identity:152/319 - (47%)
Similarity:191/319 - (59%) Gaps:20/319 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 MWLLRKCIQGPAYRKANR------IDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCE 112
            :||..:...||..::..|      :.||.|::||.|:|:|:.|..||.:.||||.|.|||..|.|
Human    17 LWLAARRFVGPRVQRLRRGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARVIMGCRDRARAE 81

  Fly   113 AARLDIMDRSRNQ-------------QLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVM 164
            .|...:....|..             :|..|.|||.||:|||.|.:....||.|||:||||||:.
Human    82 EAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLINNAGIF 146

  Fly   165 ACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNY 229
            .||...|.||||.|||||||||||||||||..||.|:|||||||||..:.:|.||.:||.||::|
Human   147 QCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQSY 211

  Fly   230 SKFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYF 294
            :|.| .||:|||||||||.:|:..|:.|.||||..|||:|||.:.||...|..:|......|..|
Human   212 NKSF-CYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAF 275

  Fly   295 FKTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGL 353
            ||||..||||.:.||..|::||.:|.|:.||....|.|...:...|..||..||.::||
Human   276 FKTPVEGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 135/266 (51%)
NADB_Rossmann 74..347 CDD:304358 143/285 (50%)
RDH14NP_065956.1 retinol-DH_like_SDR_c 43..328 CDD:212495 143/285 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H75139
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1905
SonicParanoid 1 1.000 - - X72
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.