DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and dhrs12

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001070025.1 Gene:dhrs12 / 556393 ZFINID:ZDB-GENE-060929-1134 Length:318 Species:Danio rerio


Alignment Length:297 Identity:98/297 - (32%)
Similarity:145/297 - (48%) Gaps:48/297 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 MWLLRKCIQ---GPAYRKANR----------IDGKVVIVTGCNTGIGKETVLELAKRGARVYMAC 105
            :|.| |.:|   ...|..|.|          ::|:..|:||.|:||||....|:||||..|::.|
Zfish     8 VWFL-KGLQEYTNSGYEAAERRFTPADLDVSVNGRSFIITGANSGIGKAAAYEIAKRGGTVHLVC 71

  Fly   106 RDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTL 170
            |:..|.|.||.||:::|:::.:....:|:.|.:.|..|...| ::...|.:||||||.|...|.|
Zfish    72 RNKDRAEEARKDIVEQSKSENVHVHLVDMSSPRKVWEFASGF-SQNHNLHVLINNAGCMVNQREL 135

  Fly   171 TADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKFFG- 234
            |.||.|:.|..|.||.::||..|:..||.|...|::.|||...|..::|.|||..||  ..|.| 
Zfish   136 TEDGLEKNFATNTLGTYILTTALIPTLKRSENPRVITVSSGGMLVQKLNVEDLQFEK--GSFDGT 198

  Fly   235 -AYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSG--PGWMKTALQKGSLYFF- 295
             ||:|:|...::.|.:.:|..|:.                  |||.  |||..|...:.|:..| 
Zfish   199 MAYAQNKRQQVIMTEQWATQHKEI------------------HFSSMHPGWADTPAVRSSMPDFY 245

  Fly   296 -------KTPKAGAQTQLRLAL-DPQLEGSTGGYYSD 324
                   :|...||.|.:.||: |......:|.::.|
Zfish   246 EKMKNKLRTEAQGADTVVWLAVSDAASRQPSGLFFQD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 90/270 (33%)
NADB_Rossmann 74..347 CDD:304358 91/264 (34%)
dhrs12NP_001070025.1 FabG 39..273 CDD:223959 89/254 (35%)
NADB_Rossmann 40..293 CDD:304358 91/264 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.