DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and HSD17B7

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_057455.1 Gene:HSD17B7 / 51478 HGNCID:5215 Length:341 Species:Homo sapiens


Alignment Length:298 Identity:79/298 - (26%)
Similarity:121/298 - (40%) Gaps:62/298 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVVIVTGCNTGIGKETVLELAKR------GARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLD 133
            |||::||.::|||    |.|.||      ...:.:|||:..:.||....::......::....:|
Human     3 KVVLITGASSGIG----LALCKRLLAEDDELHLCLACRNMSKAEAVCAALLASHPTAEVTIVQVD 63

  Fly   134 LGSLQSVRNFVERFKAEESRLDILINNAGVMACPR------------------------------ 168
            :.:||||....:..|....|||.:..|||:|..|:                              
Human    64 VSNLQSVFRASKELKQRFQRLDCIYLNAGIMPNPQLNIKALFFGLFSRKVIHMFSTAEGLLTQGD 128

  Fly   169 TLTADGFEQQFGVNHLGHFLLTNLLLDRLKHS-SPSRIVVVSSAAHLFGRINREDLMSEKNYSKF 232
            .:||||.::.|..|..|||:|...|...|.|| :||:::..||.:......:.||.    .:||.
Human   129 KITADGLQEVFETNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDF----QHSKG 189

  Fly   233 FGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLY---- 293
            ...||.||.|..|.::.|:......|:..|...||...|.:..... |.::.|.|....|.    
Human   190 KEPYSSSKYATDLLSVALNRNFNQQGLYSNVACPGTALTNLTYGIL-PPFIWTLLMPAILLLRFF 253

  Fly   294 ---FFKTPKAGAQTQLRL------ALDP---QLEGSTG 319
               |..||..|.:..:.|      :|:|   .|..:||
Human   254 ANAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 77/296 (26%)
NADB_Rossmann 74..347 CDD:304358 79/298 (27%)
HSD17B7NP_057455.1 3KS_SDR_c 2..280 CDD:187645 74/285 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4278
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.