DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and Rdh14

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001102746.1 Gene:Rdh14 / 500629 RGDID:1565196 Length:334 Species:Rattus norvegicus


Alignment Length:316 Identity:150/316 - (47%)
Similarity:190/316 - (60%) Gaps:17/316 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 MWLLRKCIQGPAYRK------ANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCE 112
            :||..:...|.:.::      ...:.||.|::||.|:|:|:.|..||.:.||||.|.|||..|.|
  Rat    18 LWLAARRFSGSSGQRRQGGGDPGLMHGKTVLITGANSGLGRATAGELLRLGARVIMGCRDRARAE 82

  Fly   113 AARLDIMDR----------SRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACP 167
            .|...:...          :.:.||..:.|||.||:|||.|.:....||.|||:|||||||..||
  Rat    83 EAAGQLRQELGQAGGLGPDATDGQLVVKELDLASLRSVRAFCQELLQEEPRLDVLINNAGVFQCP 147

  Fly   168 RTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKF 232
            .|.|.||||.|||||||||||||||||..||.|:|||||||||..:.:|.||.|||.||::|:|.
  Rat   148 YTKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFEDLNSEQSYNKS 212

  Fly   233 FGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFFKT 297
            | .||:|||||||||.:|:..|:.|.||||..|||:|||.:.||...|...:......|..||||
  Rat   213 F-CYSRSKLANILFTRELAHRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLARPLFNLVSWAFFKT 276

  Fly   298 PKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGL 353
            |..||||.:.||..|.:||.:|.|:.||....|.|...:...|..||..||.::|:
  Rat   277 PLEGAQTSIYLASSPDVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGI 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 135/257 (53%)
NADB_Rossmann 74..347 CDD:304358 144/282 (51%)
Rdh14NP_001102746.1 PRK06197 43..332 CDD:235737 146/289 (51%)
NADB_Rossmann 44..326 CDD:304358 144/282 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H75139
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.730

Return to query results.
Submit another query.