DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and LOC500227

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:XP_038964083.1 Gene:LOC500227 / 500227 RGDID:1566019 Length:598 Species:Rattus norvegicus


Alignment Length:337 Identity:73/337 - (21%)
Similarity:117/337 - (34%) Gaps:104/337 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 SLQSVRNFVERFKAEESRLDILINNAG------VMACPRTL----TADG---FEQQFGVNHLGHF 187
            |||.:.:.|.:..|...||:  :.|.|      :.:..|:|    |.||   |.|..|:......
  Rat   266 SLQDLYHCVPQPDAAGDRLN--LKNKGQLCRSSIGSADRSLLSVPTPDGPSPFLQPGGMERRPSH 328

  Fly   188 LLTNLLLDRLKHSSPSRI----------VVV----SSAAHLFG-RINREDLMSEKNYSKFFGAYS 237
            ....:.||      |||:          |::    :....::. |..:..:.:..:.|:..|:.:
  Rat   329 KTPTMRLD------PSRLPRHWVRPVAEVLIPDLEARPLEIYRVRPRKSQVGASASESQALGSRT 387

  Fly   238 QSKLANIL--FTLKLSTILKDTG--VTVNCCH-------------PG-------VVRTEINRHFS 278
            .|||...:  |.||.....:.:|  .|:|...             ||       :|..::   .|
  Rat   388 HSKLQVSIPRFPLKRCATFRSSGPDPTLNLAQSSPSFGSNLPFLSPGFRFLARNLVPPDV---AS 449

  Fly   279 GP------------GWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPL- 330
            .|            ||.:.|.|.|.|:      ||     |..:.||.:.......|:...||| 
  Rat   450 APSPKLWPRAKWPSGWEREAEQLGELW------AG-----RTRVPPQGQEPVEDSVSEDSGWPLA 503

  Fly   331 FPWVRNMQTADWLWR-----ESEKLLGLPPLEPPPPVQSPTQNGNGTQNGNGSSSASASASSNNP 390
            .|.|.. .|:..||:     |:.||           |...:....|||.....::....|....|
  Rat   504 VPQVLE-ATSQVLWKPMVISENMKL-----------VPGVSMWNRGTQELLNPAAIQEEAEEGTP 556

  Fly   391 ASREMQSVETVV 402
            .:.|.|.::|.|
  Rat   557 QAPEQQPIQTGV 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 51/246 (21%)
NADB_Rossmann 74..347 CDD:304358 60/280 (21%)
LOC500227XP_038964083.1 DUF4639 8..571 CDD:406041 73/337 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.