DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and dhrs13a.1

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001007364.1 Gene:dhrs13a.1 / 492491 ZFINID:ZDB-GENE-041114-58 Length:296 Species:Danio rerio


Alignment Length:296 Identity:140/296 - (47%)
Similarity:184/296 - (62%) Gaps:10/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQQLF 128
            |......|:|||.|||||.||||||.|.::||:|||||.:||||.||.:||..||...:.::::.
Zfish     4 PRCTSTARLDGKTVIVTGANTGIGKATAMDLARRGARVILACRDEGRAQAAVTDIQRETGSKEVL 68

  Fly   129 NRTLDLGSLQSVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLL 193
            ...|||.||:|||:|.|.|..:||||||||||||::...:  |.|||.:.||||||||||||:||
Zfish    69 YMHLDLASLKSVRSFAENFLKKESRLDILINNAGLVIGGK--TEDGFGRMFGVNHLGHFLLTDLL 131

  Fly   194 LDRLKHSSPSRIVVVSSAAHLFGRINREDLMSEKNYSKFFGA------YSQSKLANILFTLKLST 252
            |.|||...|||||.|||.||.:|:::...:.::|:..|...|      ||.|||.|:|||.:|:.
Zfish   132 LKRLKECGPSRIVTVSSMAHAWGKMDFNCINAQKDLGKGDSALGLLMLYSHSKLCNVLFTHELAK 196

  Fly   253 ILKDTGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGS 317
            .||.|.||....|||.::||::||.:  .|....:....|.|||...:||||.|..||...:|..
Zfish   197 RLKGTNVTCYSLHPGAIKTELSRHSN--IWWSLFMAPIFLLFFKDVVSGAQTSLHCALQEGIEPL 259

  Fly   318 TGGYYSDCMRWPLFPWVRNMQTADWLWRESEKLLGL 353
            :|.|:|.|....:....|:...|..||..||:.:||
Zfish   260 SGRYFSGCAVQNVSAKARDDAAAKKLWEISERFVGL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 127/253 (50%)
NADB_Rossmann 74..347 CDD:304358 133/278 (48%)
dhrs13a.1NP_001007364.1 PRK06196 7..294 CDD:235736 137/290 (47%)
NADB_Rossmann 14..289 CDD:304358 133/278 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D414554at33208
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100091
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X72
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.