DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and CG13833

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster


Alignment Length:257 Identity:67/257 - (26%)
Similarity:104/257 - (40%) Gaps:58/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LIFLIVLG----ILLFMWLLRKCIQGPAYRKANR-IDGKVVIVTGCNTGIGKETVLELAKRGARV 101
            :|.||.|.    :|:.:.||.:.|....:..|.: |.|:|.:|||...|:|:...|||||:|   
  Fly    15 IIALIGLAAITPLLILVALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKG--- 76

  Fly   102 YMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQSVRNFVERFKAEESRLD----------- 155
                     |..|.:|| :.|..:....:..|:..:::     :.:||..:..|           
  Fly    77 ---------CHIAVVDI-NVSGAEDTVKQIQDIYKVRA-----KAYKANVTNYDDLVELNSKVVE 126

  Fly   156 ------ILINNAGVMACPRTLTADGFEQQ--FGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAA 212
                  :|:||||||........|..:.|  ..||...||....:.|.::|......||.:||.|
  Fly   127 EMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLA 191

  Fly   213 HLFGRINREDLMSEKNYSKFFGAYSQSKLANILFTLKLSTIL---KDTGVTVNCCHPGVVRT 271
            .:|          ...||..:.......||: :.||::...|   ||..||.  ..|..:||
  Fly   192 GVF----------PLPYSATYTTTKSGALAH-MRTLRMELDLENQKDIHVTT--VLPSFLRT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 58/224 (26%)
NADB_Rossmann 74..347 CDD:304358 57/220 (26%)
CG13833NP_651111.1 adh_short 53..241 CDD:278532 56/219 (26%)
NADB_Rossmann 54..297 CDD:304358 56/218 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.