DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and C2orf81

DIOPT Version :10

Sequence 1:NP_572316.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_001303693.1 Gene:C2orf81 / 388963 HGNCID:34350 Length:615 Species:Homo sapiens


Alignment Length:118 Identity:28/118 - (23%)
Similarity:36/118 - (30%) Gaps:42/118 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 GWMKTALQKGSLYFFKT--PKAGAQTQLRLALDPQLEGSTGGYYSDCMRWP-------------- 329
            ||...|...|.|:..:|  |..|.:...|...||.             |||              
Human   506 GWEGKAELLGELWAGRTRVPPQGLELADREGQDPG-------------RWPRTTPPVLEATSQVM 557

  Fly   330 ----LFPWVRNMQTADWLWRESEKLL---GLPPLEP------PPPVQSPTQNG 369
                |.|....:.....:|..|.::|   |:|..|.      ||..|.|.|.|
Human   558 WKPVLLPEALKLAPGVSMWNRSTQVLLSSGVPEQEDKEGSTFPPVEQHPIQTG 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_572316.1 Rossmann-fold NAD(P)(+)-binding proteins 74..347 CDD:473865 17/85 (20%)
C2orf81NP_001303693.1 DUF4639 9..614 CDD:464739 28/118 (24%)

Return to query results.
Submit another query.