DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and cbr1

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_919387.1 Gene:cbr1 / 373866 ZFINID:ZDB-GENE-030902-2 Length:276 Species:Danio rerio


Alignment Length:298 Identity:84/298 - (28%)
Similarity:121/298 - (40%) Gaps:65/298 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KVVIVTGCNTGIGKETVLELAKR-GARVYMACRDPGRCEAARLDIMDRSRNQQLFNRTLDLGSLQ 138
            ||.:|||.|.|||...|..|.|. ...||::.||.||..|| :|.:.:.....||:: ||:....
Zfish     5 KVALVTGANKGIGFAIVRALCKEYTGDVYLSSRDVGRGTAA-VDSLKKEGLHPLFHQ-LDINDPN 67

  Fly   139 SVRNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLT----NLLLDRLKH 199
            |||...:.|:.:...||:||||||:..  :......|..|..|....:|..|    |:.|..:|.
Zfish    68 SVRTARDFFQEKYGGLDVLINNAGIAF--KMADTTPFGTQADVTLKTNFFATRDMCNVFLPIIKP 130

  Fly   200 SSPSRIVVVSS----------AAHLFGRINREDLM--------------------SEKNYSKFFG 234
            .  .|:|.|||          :..|..|...:|:.                    ||:.:..  .
Zfish   131 G--GRLVNVSSGMGSMALGRCSPELQARFRSDDITEEELNGLMERFVREAQEGVHSERGWPS--T 191

  Fly   235 AYSQSKLA-NILFTLKLSTILKD---TGVTVNCCHPGVVRTEINRHFSGPGWMKTALQKGSLYFF 295
            ||..||.. ..|..::...:.|:   .|:..|.|.||.|||::    :||.            ..
Zfish   192 AYGISKTGLTTLTRIQARNLTKERPGDGILCNACCPGWVRTDM----AGPN------------AT 240

  Fly   296 KTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRWPLFPW 333
            |:|..||.|.:.|||.|.......|.:...|:  :.||
Zfish   241 KSPDEGAITPVYLALLPAGAKEPHGQFVSEMK--VQPW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 80/282 (28%)
NADB_Rossmann 74..347 CDD:304358 84/298 (28%)
cbr1NP_919387.1 carb_red_PTCR-like_SDR_c 5..276 CDD:187585 82/296 (28%)
adh_short 5..237 CDD:278532 69/243 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.