DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3842 and CG8888

DIOPT Version :9

Sequence 1:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:374 Identity:73/374 - (19%)
Similarity:122/374 - (32%) Gaps:115/374 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SEAATPPGS--VPGTVFPPGFDP---------TAESVEKTLCFRGFWAWAVLIF--LIVLGILLF 53
            |.:|.|..|  :|..:|...|.|         ....:...|.......:||.::  |..:|.:||
  Fly    21 SISALPQKSHEIPWDIFERLFMPFLFCQAAAIVTSHLLHALDISSISTFAVFVWFALATVGAVLF 85

  Fly    54 MWLLRKCIQGPAYRKANRIDGKVVIVTGCNTGIGKETVLELAKRGARVYMACRDP---------- 108
            ...::.           ...||.|::|||...:......:|...|..||.....|          
  Fly    86 YHFVKV-----------SASGKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKIL 139

  Fly   109 -----GRCEAARLD------IMDRSR--NQQLFNRTLDLGSLQSVRNFVERFKAEESRLDILINN 160
                 ||.:...||      |::.:|  :|.|.:....|.|:....:::...:.|.....:|   
  Fly   140 KEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVVHCAHWIALGELEWIPFAVL--- 201

  Fly   161 AGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRLKHSSPSRIVVVSSAAHLFGRINREDLMS 225
                           .:...:|.||...||.:.|..::.:. .|:|.::|.      :||..   
  Fly   202 ---------------RKSLDLNLLGSARLTQIFLPLVRRAH-GRVVFLTSG------LNRVP--- 241

  Fly   226 EKNYSKFFGAYSQSKLANILFTLKLSTILKDTGVTVNCCHPGVVRTEINRHFS-GPGWM-KTAL- 287
                |...|....::.|...|...|...::..||.|:....|        .|: |.||: :|.| 
  Fly   242 ----SPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAG--------EFAPGNGWLNETELR 294

  Fly   288 -------------QK---GSLYF---------FKTPKAGAQTQLRLALD 311
                         ||   |..|:         :....|..|..||:.:|
  Fly   295 DQAKQMWNQLSSEQKKTYGEDYYEAAMTSVEKYSRQAADIQPTLRVLID 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3842NP_001259270.1 FabG 71..319 CDD:223959 58/292 (20%)
NADB_Rossmann 74..347 CDD:304358 58/289 (20%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 57/288 (20%)
adh_short 96..293 CDD:278532 47/236 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.